PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0006s0130.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family TALE
Protein Properties Length: 708aa    MW: 77995.6 Da    PI: 6.0249
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0006s0130.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.72.3e-094504871954
                             HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                             Fe   ++yps +e++ LA++ gLt +qV +WF N R +
  SapurV1A.0006s0130.2.p 450 FEHflHPYPSDSEKTMLASQAGLTRSQVANWFINARVR 487
                             664459******************************88 PP

2BELL123.11.1e-39314385172
                    BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                             erq+lq+kk+kLls+leeVd++Ykqy++q+q+v+ sF++vag+g+ak+Yt+lAl++iSrhFrcL+dai++qi
  SapurV1A.0006s0130.2.p 314 ERQDLQNKKTKLLSMLEEVDRKYKQYYHQMQAVALSFDMVAGHGAAKSYTELALQTISRHFRCLRDAISGQI 385
                             799********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.4E-63235383IPR006563POX domain
PfamPF075261.5E-47241382IPR006563POX domain
PROSITE profilePS5007112.552428491IPR001356Homeobox domain
SMARTSM003892.3E-9431495IPR001356Homeobox domain
CDDcd000862.79E-12431492No hitNo description
SuperFamilySSF466891.97E-16432498IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.9E-27434497IPR009057Homeodomain-like
PfamPF059204.0E-17448487IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 708 aa     Download sequence    Send to blast
MATYYRTSSS QNSNLQTLFT GDQKGASYSE LPSDLSSMKS YTSHTPAAGS YSEILYGGSL  60
SSQNGAEFSS CGARDEIAFI PPTSDTMNLQ SAGGQLNTAA GNLVGDSVSG NSQAVPPWMQ  120
LGIPDCEQNF HSQGLPLRLG MQEQSAVSMP SLQYDQYPNR NFPSSLCSNL LVPEKWTLTC  180
EGDESNQRNE LREFEGLSGF AGSNHNPIKT ESPHNPQYIV GLGDMPADMN MYGLAGYANT  240
LLNSRYLKSV QHLLDEMINV KKALKQPQSN KCSGDNKEND RRPSPCSMLP SSNEKPSDPT  300
ESTAESTPGL SPVERQDLQN KKTKLLSMLE EVDRKYKQYY HQMQAVALSF DMVAGHGAAK  360
SYTELALQTI SRHFRCLRDA ISGQIEVIMK RLGEQGNSTN GQGGIPRLRY VDHQTRQQRA  420
LQQLGVMRHA WRPQRGLPES SVSVLRAWLF EHFLHPYPSD SEKTMLASQA GLTRSQVANW  480
FINARVRLWK PMVEDMYKEE FGDSDTNSKS SLDETTKSRG DKSDNLLTSE NRLRELYESV  540
TSAGADIAQP GKSHDIKSNH ILELEMKEPL AKIVLENGSQ GPNVAESDIM KFPRDRSLNI  600
DDDHNFCPRD NMPCDQNGDG NPMSAAAAAA YDVSHLKGFA AGSQMSLALG LQSNDSDSFP  660
TFDGAHMRGK NTSASSVGHD EVDHHCMDTG KQHDRIVNSH RLHDFVV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A2e-16437494158Homeobox protein Meis1
4xrs_B2e-16437494158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011028920.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_011028921.10.0PREDICTED: BEL1-like homeodomain protein 7
TrEMBLB9GRJ10.0B9GRJ1_POPTR; Uncharacterized protein
STRINGPOPTR_0002s03240.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16400.11e-109BEL1-like homeodomain 7